PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma76g00210.1
Common NameZOSMA_76G00210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family MIKC_MADS
Protein Properties Length: 317aa    MW: 36359.2 Da    PI: 9.7684
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma76g00210.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.61.2e-3171120150
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 
                      krienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+iifss+gklye+ 
  Zosma76g00210.1  71 KRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFG 120
                      79**********************************************95 PP

2K-box103.33.1e-34141233698
            K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                      +  + ++++++++qe++kLk ++e+L r+qRhllGedL++Ls+keLq+Le+qLe+sl++ R++K++l+l+q+eel+kke+ l ++nk+L+ k 
  Zosma76g00210.1 141 DATVVDRETQTWYQEVSKLKTKYESLMRSQRHLLGEDLGPLSVKELQHLERQLESSLSQARQRKTQLMLDQMEELRKKERHLGDINKQLKDKA 233
                      44478899*********************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.57163123IPR002100Transcription factor, MADS-box
SMARTSM004321.8E-4163122IPR002100Transcription factor, MADS-box
CDDcd002651.84E-4164135No hitNo description
SuperFamilySSF554551.11E-3364153IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-326585IPR002100Transcription factor, MADS-box
PROSITE patternPS00350065119IPR002100Transcription factor, MADS-box
PfamPF003194.3E-2772119IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-3285100IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-32100121IPR002100Transcription factor, MADS-box
PfamPF014862.6E-30147233IPR002487Transcription factor, K-box
PROSITE profilePS5129716.457149245IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0009911Biological Processpositive regulation of flower development
GO:0010094Biological Processspecification of carpel identity
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048455Biological Processstamen formation
GO:0048459Biological Processfloral whorl structural organization
GO:0048509Biological Processregulation of meristem development
GO:0048833Biological Processspecification of floral organ number
GO:0080060Biological Processintegument development
GO:0080112Biological Processseed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MSTYIEASID QLVKTWYWRD AECFLFLPQI NNQKLNKSGR GREEGEGKKE RSRENRSKTR  60
KRMGRGRVEL KRIENKINRQ VTFSKRRNGL LKKAYELSVL CDAEVALIIF SSRGKLYEFG  120
SAGGTIKTLE RYQRCCYTNE DATVVDRETQ TWYQEVSKLK TKYESLMRSQ RHLLGEDLGP  180
LSVKELQHLE RQLESSLSQA RQRKTQLMLD QMEELRKKER HLGDINKQLK DKAEGAASFR  240
EIQGPPGGGW ETEAIVASSN SFPMHSSQTN PMEYEPTLHI GYHQFVPPET AAAINTRNTT  300
ATAAGENTNF MQGWLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A3e-221542302298Developmental protein SEPALLATA 3
4ox0_B3e-221542302298Developmental protein SEPALLATA 3
4ox0_C3e-221542302298Developmental protein SEPALLATA 3
4ox0_D3e-221542302298Developmental protein SEPALLATA 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00315DAPTransfer from AT2G45650Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008797646.11e-127PREDICTED: MADS-box transcription factor 6
SwissprotQ6EU391e-112MADS6_ORYSJ; MADS-box transcription factor 6
TrEMBLA0A0K9NR530.0A0A0K9NR53_Z
STRINGGSMUA_Achr1P00750_0011e-127(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41873566
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45650.12e-88AGAMOUS-like 6